PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00019007001
Common NameGSBRNA2T00019007001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 408aa    MW: 45608.1 Da    PI: 9.2014
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00019007001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.81.4e-29186240256
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          +r+rW+++LH+rFv+a +++GGs++AtPk+i++ mkv+gLt+++vkSHLQkYR++
  GSBRNA2T00019007001 186 QRRRWSQDLHRRFVDAFRRIGGSQVATPKQIRDEMKVDGLTNDEVKSHLQKYRMH 240
                          8****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.795182242IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-26183243IPR009057Homeodomain-like
SuperFamilySSF466891.25E-15183243IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-24186240IPR006447Myb domain, plants
PfamPF002492.7E-6187238IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MVQTDKDRRM SLNLNLSMYS IAKPLSQFLD EVSRIKDNHS KLSEIDVYVG KLEEERKKID  60
VFKRELPLCM LLLNEAIERL KEEASSVMMA SNGKLDVGQG SKLENDNKKN WMSSAQLWIS  120
NSNSTNKEED RRVTQTCNNL NQGGSFTPFN PPMINCSRTE QNHQFNSRTE QNHQFNKPHH  180
IPKKEQRRRW SQDLHRRFVD AFRRIGGSQV ATPKQIRDEM KVDGLTNDEV KSHLQKYRMH  240
IRKHPLSSSD QPRETQSLIS LSRSGSPQSP LVGRGLFNNN GSHISEDDEE EEKSDGRSWR  300
VSVEENRGGG DVVEDDGVSG VDVVIHGPAD GVCAFFGEVI ATPILRRAPA VGVGVVRGYS  360
PRSSLSQARA EVSAMKSSSS GASFLSACGR HAQLHRRVGG QTMAVLT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181187PKKEQRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00019007001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9738391e-119DQ973839.1 Brassica napus clone PBCESTNA15 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013681463.10.0PREDICTED: uncharacterized protein LOC106386120
TrEMBLA0A078GAQ50.0A0A078GAQ5_BRANA; BnaC03g61720D protein
STRINGBra010581.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-134G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]